PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen04g026490.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB
Protein Properties Length: 312aa    MW: 36128.9 Da    PI: 9.689
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen04g026490.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.12.1e-181863147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      rg W + Ede+l ++v+q+G+ +W++Ia++++ gR++k+c++rw++ 
  Sopen04g026490.1 18 RGHWRPAEDEKLRQLVEQYGPQNWNSIAEKLQ-GRSGKSCRLRWFNQ 63
                      899*****************************.***********996 PP

2Myb_DNA-binding54.43e-1770114147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       r +++++E+e+l+ a++ +G++ W++I+r ++ gRt++ +k++w+ +
  Sopen04g026490.1  70 RRPFSEDEEERLIGAHRIHGNK-WALISRLFP-GRTDNAVKNHWHVL 114
                       679*******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.971364IPR017930Myb domain
SuperFamilySSF466892.85E-2916111IPR009057Homeodomain-like
SMARTSM007173.9E-151766IPR001005SANT/Myb domain
PfamPF002491.4E-171863IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-271971IPR009057Homeodomain-like
CDDcd001671.18E-132162No hitNo description
PROSITE profilePS5129426.37765119IPR017930Myb domain
SMARTSM007176.0E-1469117IPR001005SANT/Myb domain
PfamPF002492.6E-1470114IPR001005SANT/Myb domain
CDDcd001672.81E-1072115No hitNo description
Gene3DG3DSA:1.10.10.606.0E-2072118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MAEGGGSGDD TTRSSCPRGH WRPAEDEKLR QLVEQYGPQN WNSIAEKLQG RSGKSCRLRW  60
FNQLDPRINR RPFSEDEEER LIGAHRIHGN KWALISRLFP GRTDNAVKNH WHVLMARKQR  120
EQSKICGKRS LYQQQQQHDN FLSDSKSSCY GFRRRNNNNN NNNNNMRIQE GNYGSKINFF  180
EFQNPNKDRV FSMSTTYSSS SPEFCGRIGS HLFRESSIDQ KSLCQNNLSF SIHGRGGDNN  240
NCKRSTTFQN PFSYVDRNEY DSITERVVNV SNSTFSFGRI LKENIEQQKY GEEAREKKDI  300
PFIDFLGVGI SS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-30181187107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015073122.10.0PREDICTED: transcription factor MYB59-like
TrEMBLK4BT450.0K4BT45_SOLLC; Uncharacterized protein
STRINGSolyc04g064540.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.12e-65myb domain protein 52